PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G30010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 367aa    MW: 39937 Da    PI: 10.4981
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G30010.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.15.2e-15260303548
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                      +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN +Lk +
  LPERR01G30010.1 260 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENVRLKRQ 303
                      69*************************************99954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-13256331IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.323258303IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.6E-13258303No hitNo description
SuperFamilySSF579594.25E-11260306No hitNo description
PfamPF001705.6E-12260303IPR004827Basic-leucine zipper domain
CDDcd147078.05E-24260304No hitNo description
PROSITE patternPS000360263278IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MASNTGGAAA QRGRMPSLGR QGSLYSLTLD EVQSHLGEPL HSMNLDELLR SVFPDGVAAA  60
GGGGIQRREQ SSGLSRQGSI AMPPELSKKT VDEVWKGIQA APKRRNGAET GGRRRRQRQP  120
TLGEVTLEDF LVKAGVVTQG SLKEMGDGDA SGNVDPVGRG VAVAGTADLA SGAQWIERYK  180
QQIAATADVH QHGQQSVQGV YMTNRLVPQP VNVGPGAVLE PSYSDGQASS GMIGGISDSQ  240
TPGRKRGMFS GDVADKLIER RQKRMIKNRE SAARSRARKQ AYTNELENKV SRLEEENVRL  300
KRQKNAANCP SPRTKSWMKY FVLSLYQNPS INSGEQAQRI SDLTRLQGAF YFVDFKVFFL  360
LSFASWV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111118GRRRRQRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627754.11e-155PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES32e-71AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0D9V7070.0A0A0D9V707_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g59760.11e-155(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.12e-69ABA-responsive element binding protein 3